PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_020040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 163aa    MW: 18445.9 Da    PI: 6.4961
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_020040genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.47.5e-4171071101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C++dC+++pyfp ++p++f +vh++FGasnv k+l++lp e r +a+++l+yeA++r+++PvyG+vg+i++l+qq+++++ ela+++
  DCAR_020040   7 RCAACKYLRRRCPRDCIFSPYFPPTNPHRFSCVHRIFGASNVGKMLQQLPVELRGEAAETLYYEAQCRMENPVYGCVGIITQLHQQINEAERELARAQ 104
                  6***********************************************************************************************99 PP

       DUF260  99 eel 101
                  +++
  DCAR_020040 105 AQI 107
                  985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.1046107IPR004883Lateral organ boundaries, LOB
PfamPF031958.8E-417104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MNMNSGRCAA CKYLRRRCPR DCIFSPYFPP TNPHRFSCVH RIFGASNVGK MLQQLPVELR  60
GEAAETLYYE AQCRMENPVY GCVGIITQLH QQINEAEREL ARAQAQIAFH RHASNAHRPL  120
PQQDQLEVEP SAPEAVTDSS WLDQNEFDVS ALMSPLDPAW FL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004308220.13e-56PREDICTED: LOB domain-containing protein 24-like
SwissprotP594686e-52LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A059DJZ92e-54A0A059DJZ9_EUCGR; Uncharacterized protein
TrEMBLB9SXJ81e-54B9SXJ8_RICCO; LOB domain-containing protein, putative
STRINGPOPTR_0012s13910.12e-53(Populus trichocarpa)
STRINGPOPTR_0015s13870.19e-54(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52772039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-47LOB domain-containing protein 24